Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. konkukian UPF0344 protein BT9727_1053 (BT9727_1053)

This Recombinant Bacillus thuringiensis subsp. konkukian UPF0344 protein BT9727_1053 (BT9727_1053) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

UPF0344 protein BT9727_1053

UniProt

Q6HM31

Expression Region

1-121

Origin

Bacillus thuringiensis subsp. konkukian (strain 97-27)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGFMLYMGIMKTATS NMHMWYGLKMIAGILVIGGMEMVLVKMSKNKATGAVWGLFIVALVAVFYLGLKLPIGWQV F

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Butoxyphenol
TRC-B690590-5G 5 g

4-Butoxyphenol

Sign In for Pricing
View Details
CHFR Rabbit Polyclonal Antibody
R1310-3 100 µL

CHFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ca2+/Mg2+ ATPase Microplate Assay Kit
RDSM020 100 Assays

Ca2+/Mg2+ ATPase Microplate Assay Kit

Sign In for Pricing
View Details
BNC1 Human Gene Knockout Kit (CRISPR)
KN419726 1 Kit

BNC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD302 Antibody
8C12150-AAT 50 µg

CD302 Antibody

Sign In for Pricing
View Details
mFluor™ Green 630 SE
1168-AAT 1 mg

mFluor™ Green 630 SE

Sign In for Pricing
View Details