Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. konkukian UPF0344 protein BT9727_1053 (BT9727_1053)

This Recombinant Bacillus thuringiensis subsp. konkukian UPF0344 protein BT9727_1053 (BT9727_1053) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

UPF0344 protein BT9727_1053

UniProt

Q6HM31

Expression Region

1-121

Origin

Bacillus thuringiensis subsp. konkukian (strain 97-27)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGFMLYMGIMKTATS NMHMWYGLKMIAGILVIGGMEMVLVKMSKNKATGAVWGLFIVALVAVFYLGLKLPIGWQV F

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCAT1 (NM_001178093) Human Over-expression Lysate
LC432999 20 µg

BCAT1 (NM_001178093) Human Over-expression Lysate

Sign In for Pricing
View Details
MMP3 Mouse Monoclonal Antibody [Clone ID: OTI2D4]
CF806979 100 µg

MMP3 Mouse Monoclonal Antibody [Clone ID: OTI2D4]

Sign In for Pricing
View Details
Human FAPα Antibody Pair Set
E-KAB-0425 50 µL & 100 µg

Human FAPα Antibody Pair Set

Sign In for Pricing
View Details
ARPC1B Rabbit Polyclonal Antibody
TA366528 100 µL

ARPC1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ferritin, Heavy Chain (FTH) (Microglia Marker) (FTH/2081), CF405S conjugate, 0.1mg/mL
BNC042081-500 1x 500 µL

Ferritin, Heavy Chain (FTH) (Microglia Marker) (FTH/2081), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FGL1 Polyclonal Antibody
E-AB-10321-01 20 µL

FGL1 Polyclonal Antibody

Sign In for Pricing
View Details