Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtJ (mdtJ)

This Recombinant Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

P69213

Expression Region

1-121

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REC8 Human Gene Knockout Kit (CRISPR)
KN400132 1 Kit

REC8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS629188 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
FANCA Rabbit Polyclonal Antibody
TA376120 100 µL

FANCA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF488A conjugate, 0.1mg/mL
BNC882554-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI2F10]
CF807908 100 µg

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI2F10]

Sign In for Pricing
View Details
Recombinant Mouse VNN1/Vanin-1 Protein (His Tag)
PKSM040423 100 µg

Recombinant Mouse VNN1/Vanin-1 Protein (His Tag)

Sign In for Pricing
View Details