Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtJ (mdtJ)

This Recombinant Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

P69213

Expression Region

1-121

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary
CS620024 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
(±)-Napropamide-d10 (N,N-diethyl-d10)
TRC-N378701-5MG 5 mg

(±)-Napropamide-d10 (N,N-diethyl-d10)

Sign In for Pricing
View Details
CD8A Rabbit Monoclonal Antibody
TA422533 100 µL

CD8A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
RIP3 (RIPK3) (Center) Rabbit Polyclonal Antibody
AP13847PU-N 400 µL

RIP3 (RIPK3) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human WFDC10B activation kit by CRISPRa
GA116960 1 Kit

Human WFDC10B activation kit by CRISPRa

Sign In for Pricing
View Details
Cped1 Mouse Gene Knockout Kit (CRISPR)
KN503753 1 Kit

Cped1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details