Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtJ (mdtJ)

This Recombinant Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

P69213

Expression Region

1-121

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVKKIALGVA YALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGA V

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetyl-L-aspartic Acid
TRC-A168605-5G 5 g

N-Acetyl-L-aspartic Acid

Sign In for Pricing
View Details
TPD52L2 Rabbit Polyclonal Antibody
TA362195 100 µL

TPD52L2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PTGR1 activation kit by CRISPRa
GA107933 1 Kit

Human PTGR1 activation kit by CRISPRa

Sign In for Pricing
View Details
MAGP2 (MFAP5) (NM_003480) Human Over-expression Lysate
LC401177 20 µg

MAGP2 (MFAP5) (NM_003480) Human Over-expression Lysate

Sign In for Pricing
View Details
CBFB Polyclonal Antibody
E-AB-52520-01 20 µL

CBFB Polyclonal Antibody

Sign In for Pricing
View Details
CBFB Polyclonal Antibody
E-AB-52520-02 60 µL

CBFB Polyclonal Antibody

Sign In for Pricing
View Details