Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0382 membrane protein SAS0541 (SAS0541)

This Recombinant Staphylococcus aureus UPF0382 membrane protein SAS0541 (SAS0541) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

UPF0382 membrane protein SAS0541

UniProt

Q6GBQ4

Expression Region

1-122

Origin

Staphylococcus aureus (strain MSSA476)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGGVLFIIGWIMLIIATFKF AG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-500 1x 500 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF740 conjugate, 0.1mg/mL
BNC740345-500 1x 500 µL

CD4 (EDU-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
BNC740806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
BNC040218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF405S conjugate, 0.1mg/mL
BNC042110-100 1x 100 µL

PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/818), CF488A conjugate, 0.1mg/mL
BNC880818-500 1x 500 µL

CD45RA (PTPRC/818), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details