Recombinant Shewanella sp. Protein CrcB homolog (crcB)
This Recombinant Shewanella sp. Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-124.
Product Specifications
Product Name Alternative
Protein CrcB homolog
UniProt
Q0HIS8
Expression Region
1-124
Origin
Shewanella sp. (strain MR-4)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNNLLLVALGGSIGAVFRYLISIFMIQVFGSSFPFGTLLVNVLGSFLMGVIYALGQMSHI SPELKALIGVGLLGALTTFSTFSNETLLLMQEGDWLKAALNVVLNLSLCLFMVYLGQQLV FSRI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942216-100 1x 100 µL
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941855-500 1x 500 µL
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681468-100 1x 100 µL
MCM7 (Proliferation Marker) (MCM7/1468), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 