Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bactoprenol-linked glucose translocase (rfbI)

This Recombinant Bactoprenol-linked glucose translocase (rfbI) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Bactoprenol-linked glucose translocase

UniProt

P37785

Expression Region

1-124

Origin

Shigella flexneri

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKIGKLLTSSFFSYFLIGIVNTALHWGVFYACYNNLAFGQGRSNIVGFICAATFSFFAN ARCSFKVSATKARYFIFIFFMGAMSYLFGVLFDLLALSPIFTLFTFSLFSLVLGYCASKY FIFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL
BNC881820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF488A conjugate, 0.1mg/mL
BNC880861-500 1x 500 µL

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (135-4C5), CF568 conjugate, 0.1mg/mL
BNC680172-100 1x 100 µL

CD45 / LCA (135-4C5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-1 (SUMO1/1188), CF640R conjugate, 0.1mg/mL
BNC401188-500 1x 500 µL

SUMO-1 (SUMO1/1188), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details