Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycerol dehydrogenase small subunit (sldB)

This Recombinant Glycerol dehydrogenase small subunit (sldB) spans the amino acid sequence from region 2-126.

Product Specifications

Product Name Alternative

Glycerol dehydrogenase small subunit, EC= 1.1.99.22, D-arabitol dehydrogenase small subunit, ARDH, D-sorbitol dehydrogenase subunit sldB, SLDH, Gluconate/polyol

UniProt

Q8L1D5

Expression Region

2-126

Origin

Gluconobacter thailandicus

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PNLQGNRTLTEWLTLLLGVIVLLVGLFFVIGGADLAMLGGSTYYVLCGILLVASGVFMLM GRTLGAFLYLGALAYTWVWSFWEVGFSPIDLLPRAFGPTILGILVALTIPVLRRMESRRT LRGAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P75 NGF Receptor Recombinant Rat Monoclonal Antibody
HA610274 100 µg

P75 NGF Receptor Recombinant Rat Monoclonal Antibody

Sign In for Pricing
View Details
2,2,4,4,6,6-Hexakis[(2,2,3,3,4,4,5,5-octafluoropentyl)oxy]-2Lambda5,4Lambda5,6Lambda5-1,3,5,2,4,6-triazatriphosphorine
TRC-H293970-5MG 5 mg

2,2,4,4,6,6-Hexakis[(2,2,3,3,4,4,5,5-octafluoropentyl)oxy]-2Lambda5,4Lambda5,6Lambda5-1,3,5,2,4,6-triazatriphosphorine

Sign In for Pricing
View Details
NF2 Human Gene Knockout Kit (CRISPR)
KN400690 1 Kit

NF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL8 (CXCL8) Rabbit Monoclonal Antibody
TA424088 100 µL

IL8 (CXCL8) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human PDZD8 activation kit by CRISPRa
GA114680 1 Kit

Human PDZD8 activation kit by CRISPRa

Sign In for Pricing
View Details
EFTUD2 Human Gene Knockout Kit (CRISPR)
KN401823 1 Kit

EFTUD2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details