Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycerol dehydrogenase small subunit (sldB)

This Recombinant Glycerol dehydrogenase small subunit (sldB) spans the amino acid sequence from region 2-126.

Product Specifications

Product Name Alternative

Glycerol dehydrogenase small subunit, EC= 1.1.99.22, D-arabitol dehydrogenase small subunit, ARDH, D-sorbitol dehydrogenase subunit sldB, SLDH, Gluconate/polyol

UniProt

Q8L1D5

Expression Region

2-126

Origin

Gluconobacter thailandicus

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PNLQGNRTLTEWLTLLLGVIVLLVGLFFVIGGADLAMLGGSTYYVLCGILLVASGVFMLM GRTLGAFLYLGALAYTWVWSFWEVGFSPIDLLPRAFGPTILGILVALTIPVLRRMESRRT LRGAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBLN2 Antibody
8C15753-AAT 50 µg

FBLN2 Antibody

Sign In for Pricing
View Details
ALG1L2 (NM_001136152) Human Over-expression Lysate
LC427825 20 µg

ALG1L2 (NM_001136152) Human Over-expression Lysate

Sign In for Pricing
View Details
KLHL29 Rabbit Polyclonal Antibody
TA366658 100 µL

KLHL29 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human IFNA16 activation kit by CRISPRa
GA102336 1 Kit

Human IFNA16 activation kit by CRISPRa

Sign In for Pricing
View Details
NR2C1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D11]
TA803354AM 100 µL

NR2C1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D11]

Sign In for Pricing
View Details
VEZT (NM_017599) Human Recombinant Protein
TP314205M 100 µg

VEZT (NM_017599) Human Recombinant Protein

Sign In for Pricing
View Details