Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0344 protein SAV0969 (SAV0969)

This Recombinant Staphylococcus aureus UPF0344 protein SAV0969 (SAV0969) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

UPF0344 protein SAV0969

UniProt

Q99VC1

Expression Region

1-129

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLG PISKLFGIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

scyllo-Inositol-d6
TRC-I666053-10MG 10 mg

scyllo-Inositol-d6

Sign In for Pricing
View Details
RNA- Loading Buffer
40120970-1 10 mL

RNA- Loading Buffer

Sign In for Pricing
View Details
RNAS2 Protein (C-His, Human)
P518048 100 µg

RNAS2 Protein (C-His, Human)

Sign In for Pricing
View Details
Histone cluster 1 H4H CRISPR Activation Plasmid (h)
sc-411164-ACT 20 µg

Histone cluster 1 H4H CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Human CCAAT/enhancer binding protein epsilon, C/EBPε ELISA Kit
CK-bio-10808-01 48 Tests

Human CCAAT/enhancer binding protein epsilon, C/EBPε ELISA Kit

Sign In for Pricing
View Details
Human CCAAT/enhancer binding protein epsilon, C/EBPε ELISA Kit
CK-bio-10808-02 96 Tests

Human CCAAT/enhancer binding protein epsilon, C/EBPε ELISA Kit

Sign In for Pricing
View Details