Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0344 protein SAV0969 (SAV0969)

This Recombinant Staphylococcus aureus UPF0344 protein SAV0969 (SAV0969) spans the amino acid sequence from region 1-129.

Product Specifications

Product Name Alternative

UPF0344 protein SAV0969

UniProt

Q99VC1

Expression Region

1-129

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHLHILSWVLAIILFIATYLNISKNQGGSPFFKPLHMILRLFMLLTLISGFWILIQSFM NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHKMFWITMALIIITMVLGVILPLG PISKLFGIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPGRIP1L Antibody
MBS9603399-01 0.1 mL

RPGRIP1L Antibody

Sign In for Pricing
View Details
RPGRIP1L Antibody
MBS9603399-02 0.2 mL

RPGRIP1L Antibody

Sign In for Pricing
View Details
RPGRIP1L Antibody
MBS9603399-03 5x 0.2 mL

RPGRIP1L Antibody

Sign In for Pricing
View Details
T4S4 Rabbit Polyclonal Antibody (N-term)
E28PB2728 100 µL

T4S4 Rabbit Polyclonal Antibody (N-term)

Sign In for Pricing
View Details
PF4 Antibody (Biotin)
orb415700-01 50 µg

PF4 Antibody (Biotin)

Sign In for Pricing
View Details
PF4 Antibody (Biotin)
orb415700-02 100 µg

PF4 Antibody (Biotin)

Sign In for Pricing
View Details