Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Holin-like protein CidA (cidA)

This Recombinant Staphylococcus epidermidis Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

Q5HL70

Expression Region

1-130

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKAKFVIKLILQLALIMLITFIGTEVQKLLHIPLAGSIVGLMLFFLLLQFKIVPESWIN VGADFLLKTMVFFFIPSVVGIMDVASNITMNYILFFIVIIIGTCLVALSSGYIAEKMLEK SNTRKGTDHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lens culinaris Lectin (LCA/LCH) - Biotinylated
21510070-1 5mg

Lens culinaris Lectin (LCA/LCH) - Biotinylated

Sign In for Pricing
View Details
Il6 Mouse shRNA Plasmid (Locus ID 16193)
TG501087 1 Kit

Il6 Mouse shRNA Plasmid (Locus ID 16193)

Sign In for Pricing
View Details
PLEKHH2 siRNA (Human)
CRJ5025-01 15 nmol

PLEKHH2 siRNA (Human)

Sign In for Pricing
View Details
PLEKHH2 siRNA (Human)
CRJ5025-02 30 nmol

PLEKHH2 siRNA (Human)

Sign In for Pricing
View Details
FAM154B (SAXO2) (NM_001008226) Human Over-expression Lysate
LC423403 20 µg

FAM154B (SAXO2) (NM_001008226) Human Over-expression Lysate

Sign In for Pricing
View Details
HOPX Human Over-expression Lysate
orb1351669 100 µg

HOPX Human Over-expression Lysate

Sign In for Pricing
View Details