Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Holin-like protein CidA (cidA)

This Recombinant Staphylococcus epidermidis Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

Q5HL70

Expression Region

1-130

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKAKFVIKLILQLALIMLITFIGTEVQKLLHIPLAGSIVGLMLFFLLLQFKIVPESWIN VGADFLLKTMVFFFIPSVVGIMDVASNITMNYILFFIVIIIGTCLVALSSGYIAEKMLEK SNTRKGTDHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEL308 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
23178061 1.0 µg DNA

HEL308 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human GPX8 Protein Lysate 20ug
IHUGPX8PLLY20UG 20 µg

Human GPX8 Protein Lysate 20ug

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS813146 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
CLMN AAV Vector (Human) (CMV)
16358101 1 µg

CLMN AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Rabbit Monoclonal Serpin I1/Neuroserpin Antibody (009)
NBP2-90746-50ul 50 µL

Rabbit Monoclonal Serpin I1/Neuroserpin Antibody (009)

Sign In for Pricing
View Details
Human Anti-epidemic parotitis antibody (EP-Ab) ELISA Kit
SL0171Hu-01 48 Tests

Human Anti-epidemic parotitis antibody (EP-Ab) ELISA Kit

Sign In for Pricing
View Details