Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

P60645

Expression Region

1-131

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA8 Rabbit Polyclonal Antibody
MBS9466276-01 0.05 mL

CA8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CA8 Rabbit Polyclonal Antibody
MBS9466276-02 0.1 mL

CA8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CA8 Rabbit Polyclonal Antibody
MBS9466276-03 5x 0.1 mL

CA8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pasteurella multocida One-Step PCR kit
Oneq-VH019-150D 150 Reactions

Pasteurella multocida One-Step PCR kit

Sign In for Pricing
View Details
PDK4 Antibody
31258 100 µL

PDK4 Antibody

Sign In for Pricing
View Details
SLC25A30 (NM_001010875) Human Tagged Lenti ORF Clone
RC212728L1 10 µg

SLC25A30 (NM_001010875) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details