Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

P60645

Expression Region

1-131

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-3-Cyclopropylalanine
OR451164-01 250 mg

Boc-3-Cyclopropylalanine

Sign In for Pricing
View Details
Boc-3-Cyclopropylalanine
OR451164-02 1 g

Boc-3-Cyclopropylalanine

Sign In for Pricing
View Details
Neuromodulin (GAP43) Antibody
abx130284-01 100 µL

Neuromodulin (GAP43) Antibody

Sign In for Pricing
View Details
Neuromodulin (GAP43) Antibody
abx130284-02 200 µL

Neuromodulin (GAP43) Antibody

Sign In for Pricing
View Details
Neuromodulin (GAP43) Antibody
abx130284-03 1 mL

Neuromodulin (GAP43) Antibody

Sign In for Pricing
View Details
PIP5K1A, NT (Phosphatidylinositol-4-phosphate 5-kinase Type-1 alpha, PtdIns (4) P-5-Kinase alpha, PIP5KI-alpha, Phosphatidylinositol-4-phosphate 5-kinase Type I alpha, 68kD Type I Phosphatidylinositol-4-phosphate 5-kinase alpha, PIP5KIalpha) (MaxLight 405) discontinued
P4071-76A-ML405 100 µL

PIP5K1A, NT (Phosphatidylinositol-4-phosphate 5-kinase Type-1 alpha, PtdIns (4) P-5-Kinase alpha, PIP5KI-alpha, Phosphatidylinositol-4-phosphate 5-kinase Type I alpha, 68kD Type I Phosphatidylinositol-4-phosphate 5-kinase alpha, PIP5KIalpha) (MaxLight 405) discontinued

Sign In for Pricing
View Details