Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leptin receptor overlapping transcript-like 1 (LEPROTL1)

This Recombinant Human Leptin receptor overlapping transcript-like 1 (LEPROTL1) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor overlapping transcript-like 1

UniProt

O95214

Expression Region

1-131

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-methylene-1-nitrosopiperidine
CS-O-58246 1 Each

4-methylene-1-nitrosopiperidine

Sign In for Pricing
View Details
SEMA6B 3'UTR Lenti-reporter-Luc Vector
43358081 1.0 µg

SEMA6B 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Creatine kinase-M shRNA (h) Lentiviral Particles
sc-35109-V 200 µL

Creatine kinase-M shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Human Gastric triacylglycerol lipase ELISA Kit
MBS2885004-01 48 Well

Human Gastric triacylglycerol lipase ELISA Kit

Sign In for Pricing
View Details
Human Gastric triacylglycerol lipase ELISA Kit
MBS2885004-02 96 Well

Human Gastric triacylglycerol lipase ELISA Kit

Sign In for Pricing
View Details
Human Gastric triacylglycerol lipase ELISA Kit
MBS2885004-03 5x 96 Well

Human Gastric triacylglycerol lipase ELISA Kit

Sign In for Pricing
View Details