Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leptin receptor overlapping transcript-like 1 (LEPROTL1)

This Recombinant Human Leptin receptor overlapping transcript-like 1 (LEPROTL1) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor overlapping transcript-like 1

UniProt

O95214

Expression Region

1-131

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSR4 Polyclonal Conjugated Antibody
C31424 100 µL

SSR4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
MRPL32 Rabbit pAb (APR17650N)
APR17650N-01 50 µL

MRPL32 Rabbit pAb (APR17650N)

Sign In for Pricing
View Details
MRPL32 Rabbit pAb (APR17650N)
APR17650N-02 100 µL

MRPL32 Rabbit pAb (APR17650N)

Sign In for Pricing
View Details
MRPL32 Rabbit pAb (APR17650N)
APR17650N-03 200 µL

MRPL32 Rabbit pAb (APR17650N)

Sign In for Pricing
View Details
CCDC141 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
15205154 3x 1.0 µg DNA

CCDC141 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
PLV3-U6-GABBR2-shRNA1-Puro Plasmid
PVT73001 2 µg

PLV3-U6-GABBR2-shRNA1-Puro Plasmid

Sign In for Pricing
View Details