Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable cytochrome c oxidase polypeptide 4 (ctaF)

This Recombinant Probable cytochrome c oxidase polypeptide 4 (ctaF) spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

Probable cytochrome c oxidase polypeptide 4, EC= 1.9.3.1, Cytochrome aa3 subunit 4, Cytochrome c oxidase polypeptide IV

UniProt

Q73YL6

Expression Region

1-139

Origin

Mycobacterium paratuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHIEARLFEFIAGFFFLTALLYGVLTALFATGGEEWAGTTALALTGGLALIVATFFRFVA RRIDTRPEDYEGAEISDGAGELGFFSPHSWWPILIALSGSVAAVGIALWLPWLIVAGVMF ILSSVAGLVFEYYLGPEKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dmd Mouse Pre-designed siRNA Set A
HY-RS18019 1 Set

Dmd Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
RPL36AP34 Adenovirus (Human)
41561051 1.0 mL

RPL36AP34 Adenovirus (Human)

Sign In for Pricing
View Details
5- (Dimethylamino) -2-Nitrosophenol Hydrochloride
OR1024668-01 1 g

5- (Dimethylamino) -2-Nitrosophenol Hydrochloride

Sign In for Pricing
View Details
5- (Dimethylamino) -2-Nitrosophenol Hydrochloride
OR1024668-02 5 g

5- (Dimethylamino) -2-Nitrosophenol Hydrochloride

Sign In for Pricing
View Details
5- (Dimethylamino) -2-Nitrosophenol Hydrochloride
OR1024668-03 25 g

5- (Dimethylamino) -2-Nitrosophenol Hydrochloride

Sign In for Pricing
View Details
5- (Dimethylamino) -2-Nitrosophenol Hydrochloride
OR1024668-04 100 g

5- (Dimethylamino) -2-Nitrosophenol Hydrochloride

Sign In for Pricing
View Details