Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable cytochrome c oxidase polypeptide 4 (ctaF)

This Recombinant Probable cytochrome c oxidase polypeptide 4 (ctaF) spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

Probable cytochrome c oxidase polypeptide 4, EC= 1.9.3.1, Cytochrome aa3 subunit 4, Cytochrome c oxidase polypeptide IV

UniProt

Q73YL6

Expression Region

1-139

Origin

Mycobacterium paratuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHIEARLFEFIAGFFFLTALLYGVLTALFATGGEEWAGTTALALTGGLALIVATFFRFVA RRIDTRPEDYEGAEISDGAGELGFFSPHSWWPILIALSGSVAAVGIALWLPWLIVAGVMF ILSSVAGLVFEYYLGPEKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Isopropyl-1,2,3,4-tetrahydroquinoline
OR1057926 250 mg

6-Isopropyl-1,2,3,4-tetrahydroquinoline

Sign In for Pricing
View Details
AADAT Polyclonal Antibody
MBS9431768-01 0.05 mL

AADAT Polyclonal Antibody

Sign In for Pricing
View Details
AADAT Polyclonal Antibody
MBS9431768-02 0.1 mL

AADAT Polyclonal Antibody

Sign In for Pricing
View Details
AADAT Polyclonal Antibody
MBS9431768-03 5x 0.1 mL

AADAT Polyclonal Antibody

Sign In for Pricing
View Details
Human SH2D3A activation kit by CRISPRa
GA106802 1 Kit

Human SH2D3A activation kit by CRISPRa

Sign In for Pricing
View Details
Nup50 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4471707 1.0 µg DNA

Nup50 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details