Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable cytochrome c oxidase polypeptide 4 (ctaF)

This Recombinant Probable cytochrome c oxidase polypeptide 4 (ctaF) spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

Probable cytochrome c oxidase polypeptide 4, EC= 1.9.3.1, Cytochrome aa3 subunit 4, Cytochrome c oxidase polypeptide IV

UniProt

Q73YL6

Expression Region

1-139

Origin

Mycobacterium paratuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHIEARLFEFIAGFFFLTALLYGVLTALFATGGEEWAGTTALALTGGLALIVATFFRFVA RRIDTRPEDYEGAEISDGAGELGFFSPHSWWPILIALSGSVAAVGIALWLPWLIVAGVMF ILSSVAGLVFEYYLGPEKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nnt-set siRNA/shRNA/RNAi Lentivector (Rat)
31968096 4x 500 ng

Nnt-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
HPV16 E7 Polyclonal Antibody, Cy5 Conjugated
bs-10446R-Cy5-TR 20 µL

HPV16 E7 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Rat Interleukin 7 Receptor (IL7R) ELISA Kit
MBS2703875-01 24 Strip Well

Rat Interleukin 7 Receptor (IL7R) ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 7 Receptor (IL7R) ELISA Kit
MBS2703875-02 48 Well

Rat Interleukin 7 Receptor (IL7R) ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 7 Receptor (IL7R) ELISA Kit
MBS2703875-03 96 Well

Rat Interleukin 7 Receptor (IL7R) ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 7 Receptor (IL7R) ELISA Kit
MBS2703875-04 5x 96 Well

Rat Interleukin 7 Receptor (IL7R) ELISA Kit

Sign In for Pricing
View Details