Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

Q6GJ46

Expression Region

1-141

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIMPTFFGKPFLSQYETTLTLPILGHIHVTTITLFELG ILFSVVGVIVTVMLSLSGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP-2 Lentiviral Activation Particles (m2)
sc-419342-LAC-2 200 µL

BMP-2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
PRKD1 CRISPRa sgRNA lentivector (set of three targets)(Human)
37648121 3x 1.0µg DNA

PRKD1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant Human IL-17RA/CD217 Protein
E900273P 10 µg

Recombinant Human IL-17RA/CD217 Protein

Sign In for Pricing
View Details
P-gp inhibitor 1 50mg
A13384-50 50 mg

P-gp inhibitor 1 50mg

Sign In for Pricing
View Details
Chitin (from shrimp shells)
orb2941191-01 100 mg

Chitin (from shrimp shells)

Sign In for Pricing
View Details
Chitin (from shrimp shells)
orb2941191-02 50 mg

Chitin (from shrimp shells)

Sign In for Pricing
View Details