Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

P60677

Expression Region

1-142

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTNL8 (NM_001040462) Human Recombinant Protein
TP315370M 100 µg

BTNL8 (NM_001040462) Human Recombinant Protein

Sign In for Pricing
View Details
Fenspiride N-Oxide
TRC-F265010-250MG 250 mg

Fenspiride N-Oxide

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791), CF740 conjugate, 0.1mg/mL
BNC740791-100 1x 100 µL

Smooth Muscle Actin (ACTA2/791), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Acetylcholinesterase Reagent
DACEN25ML 100 Tests

Acetylcholinesterase Reagent

Sign In for Pricing
View Details
PEX3 Antibody
8C17624-AAT 50 µg

PEX3 Antibody

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PAX5/3735), CF640R conjugate, 0.1mg/mL
BNC403735-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (PAX5/3735), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details