Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

P60677

Expression Region

1-142

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bbs5 Mouse Gene Knockout Kit (CRISPR)
KN502000 1 Kit

Bbs5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Benzyl 2-Acetamido-4,6-O-benzylidene-2-deoxy-a-D-glucopyranoside
TRC-B211000-5G 5 g

Benzyl 2-Acetamido-4,6-O-benzylidene-2-deoxy-a-D-glucopyranoside

Sign In for Pricing
View Details
USP7 (NM_003470) Human Over-expression Lysate
LC401171 20 µg

USP7 (NM_003470) Human Over-expression Lysate

Sign In for Pricing
View Details
LOX Recombinant Rabbit monoclonal Antibody
HA751556 100 µL

LOX Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Testis
CR559766 5 µg

Tissue Total RNA, Testis

Sign In for Pricing
View Details
ARAP3 Antibody
KC-28247-01 50 μL

ARAP3 Antibody

Sign In for Pricing
View Details