Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage lambda Protein rexB (rexB)

This Recombinant Enterobacteria phage lambda Protein rexB (rexB) spans the amino acid sequence from region 1-144.

Product Specifications

Product Name Alternative

Protein rexB

UniProt

P03759

Expression Region

1-144

Origin

Enterobacteria phage lambda (Bacteriophage lambda)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNRIMPGVYIVIIPYVIVSICYLLFRHYIPGVSFSAHRDGLGATLSSYAGTMIAILIAA LTFLIGSRTRRLAKIREYGYMTSVVIVYALSFVELGALFFCGLLLLSSISGYMIPTIAIG IASASFIHICILVFQLYNLTREQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACOX1 (NM_004035) Human Tagged Lenti ORF Clone
RC200230L3 10 µg

ACOX1 (NM_004035) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat Na-K-ATPase ELISA Kit
E110628 1 Each

Rat Na-K-ATPase ELISA Kit

Sign In for Pricing
View Details
VAMP1 Antibody
orb2807866 100 µL

VAMP1 Antibody

Sign In for Pricing
View Details
Recombinant Human CD19 Fc Chimera Avi-tag Protein CF
AVI9269-050 50 µg

Recombinant Human CD19 Fc Chimera Avi-tag Protein CF

Sign In for Pricing
View Details
BNIP1 (NM_001205) Human Over-expression Lysate
LY400484 100 µg

BNIP1 (NM_001205) Human Over-expression Lysate

Sign In for Pricing
View Details
PIP5K3 (PIKFYVE) (NM_015040) Human Untagged Clone
SC121037 10 µg

PIP5K3 (PIKFYVE) (NM_015040) Human Untagged Clone

Sign In for Pricing
View Details