Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oceanobacillus iheyensis Probable disulfide formation protein (bdbC)

This Recombinant Oceanobacillus iheyensis Probable disulfide formation protein (bdbC) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Probable disulfide formation protein, Disulfide oxidoreductase, Thiol-disulfide oxidoreductase

UniProt

Q8ERY3

Expression Region

1-145

Origin

Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKLTKKAENLLLLIWVQAFLALAGSLFYSEVMNYVPCELCWYQRILMYPLVLIYGVAAI KKDISFALPGLFMSGIGLLVSTYHYLVQHVSIFQEVGGACSGSVPCNVIYVNYFGFISIP FMAGVAFLIIFVLHLLILREQGRKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCM2 antibody
MBS831007-01 0.1 mL

CCM2 antibody

Sign In for Pricing
View Details
CCM2 antibody
MBS831007-02 5x 0.1 mL

CCM2 antibody

Sign In for Pricing
View Details
T3JAM Polyclonal Antibody
ABP52548-01 30 µL

T3JAM Polyclonal Antibody

Sign In for Pricing
View Details
T3JAM Polyclonal Antibody
ABP52548-02 100 µL

T3JAM Polyclonal Antibody

Sign In for Pricing
View Details
T3JAM Polyclonal Antibody
ABP52548-03 200 µL

T3JAM Polyclonal Antibody

Sign In for Pricing
View Details
Assurance Grade Sodium for AA and ICP 1000 ug/mL (1000 PPM) 30mL in 2% HNO3
PLNA2-2M 30 mL

Assurance Grade Sodium for AA and ICP 1000 ug/mL (1000 PPM) 30mL in 2% HNO3

Sign In for Pricing
View Details