Recombinant Oceanobacillus iheyensis Probable disulfide formation protein (bdbC)
This Recombinant Oceanobacillus iheyensis Probable disulfide formation protein (bdbC) spans the amino acid sequence from region 1-145.
Product Specifications
Product Name Alternative
Probable disulfide formation protein, Disulfide oxidoreductase, Thiol-disulfide oxidoreductase
UniProt
Q8ERY3
Expression Region
1-145
Origin
Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKKLTKKAENLLLLIWVQAFLALAGSLFYSEVMNYVPCELCWYQRILMYPLVLIYGVAAI KKDISFALPGLFMSGIGLLVSTYHYLVQHVSIFQEVGGACSGSVPCNVIYVNYFGFISIP FMAGVAFLIIFVLHLLILREQGRKA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VP 830SV-850RB-EXP-01 1 EACH
SpinVessel®, 850mL, Round Bottom, Disposable, Sterile, RNase, DNase and DNA Free, Nonpyrogenic, Virgin Polypropylene, with Pulsed Radial Flow Side Fins and Projections, Individually Packaged and Sealed, US Patent #11,623,188, European Patent #3887049, The expiration date serves as a recommended use-by guideline, primarily to account for scenarios where consumables may have been exposed to harsh environmental conditions, such as extreme temperatures or prolonged light exposure. These factors can potentially alter the material properties of the plastic over time. However, every SpinVessel is stored in its original cardboard shipping container within an ambient temperature warehouse, shielded from light and any extreme environmental influences, ensuring optimal preservation.
Sign In for Pricing
View Details VP 830SV-850RB-EXP-02 48/PK
SpinVessel®, 850mL, Round Bottom, Disposable, Sterile, RNase, DNase and DNA Free, Nonpyrogenic, Virgin Polypropylene, with Pulsed Radial Flow Side Fins and Projections, Individually Packaged and Sealed, US Patent #11,623,188, European Patent #3887049, The expiration date serves as a recommended use-by guideline, primarily to account for scenarios where consumables may have been exposed to harsh environmental conditions, such as extreme temperatures or prolonged light exposure. These factors can potentially alter the material properties of the plastic over time. However, every SpinVessel is stored in its original cardboard shipping container within an ambient temperature warehouse, shielded from light and any extreme environmental influences, ensuring optimal preservation.
Sign In for Pricing
View Details 
031608-ML490 100 µL
ADAM9, CT (ADAM9, KIAA0021, MCMP, MDC9, MLTNG, Disintegrin and metalloproteinase domain-containing protein 9, Cellular disintegrin-related protein, Meltrin-gamma, Metalloprotease/disintegrin/cysteine-rich protein 9, Myeloma cell metalloproteinase) (MaxLight 490) discontinued
Sign In for Pricing
View Details 