Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oceanobacillus iheyensis Probable disulfide formation protein (bdbC)

This Recombinant Oceanobacillus iheyensis Probable disulfide formation protein (bdbC) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Probable disulfide formation protein, Disulfide oxidoreductase, Thiol-disulfide oxidoreductase

UniProt

Q8ERY3

Expression Region

1-145

Origin

Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKLTKKAENLLLLIWVQAFLALAGSLFYSEVMNYVPCELCWYQRILMYPLVLIYGVAAI KKDISFALPGLFMSGIGLLVSTYHYLVQHVSIFQEVGGACSGSVPCNVIYVNYFGFISIP FMAGVAFLIIFVLHLLILREQGRKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tert-Butyl (1- (6- (cyclopropylamino) pyrimidin-4-yl) piperidin-3-yl) (methyl) carbamate
OR1044602-01 100 mg

Tert-Butyl (1- (6- (cyclopropylamino) pyrimidin-4-yl) piperidin-3-yl) (methyl) carbamate

Sign In for Pricing
View Details
Tert-Butyl (1- (6- (cyclopropylamino) pyrimidin-4-yl) piperidin-3-yl) (methyl) carbamate
OR1044602-02 250 mg

Tert-Butyl (1- (6- (cyclopropylamino) pyrimidin-4-yl) piperidin-3-yl) (methyl) carbamate

Sign In for Pricing
View Details
Tert-Butyl (1- (6- (cyclopropylamino) pyrimidin-4-yl) piperidin-3-yl) (methyl) carbamate
OR1044602-03 1 g

Tert-Butyl (1- (6- (cyclopropylamino) pyrimidin-4-yl) piperidin-3-yl) (methyl) carbamate

Sign In for Pricing
View Details
Gentian violet for microscopy
GRM6354-25G 1 unit

Gentian violet for microscopy

Sign In for Pricing
View Details
Recombinant Anti-SESN1 Rabbit mAb
CMA6083-01 30 µL

Recombinant Anti-SESN1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-SESN1 Rabbit mAb
CMA6083-02 50 μL

Recombinant Anti-SESN1 Rabbit mAb

Sign In for Pricing
View Details