Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Antiholin-like protein LrgA (lrgA)

This Recombinant Staphylococcus aureus Antiholin-like protein LrgA (lrgA) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Antiholin-like protein LrgA

UniProt

P72358

Expression Region

1-147

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVVKQQKDASKPAHFFHQVIVIALVLFVSKIIESFMPIPMPASVIGLVLLFVLLCTGAVK LGEVEKVGTTLTNNIGLLFVPAGISVVNSLGVISQAPFLIIGLIIVSTILLLICTGYVTQ IIMKVTSRSKGDKVTKKIKIEEAQAHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (3F7B5), CF405S conjugate, 0.1mg/mL
BNC040428-100 1x 100 µL

CD6 (3F7B5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.7), CF594 conjugate, 0.1mg/mL
BNC940014-100 1x 100 µL

CD31 / PECAM-1 (C31.7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF568 conjugate, 0.1mg/mL
BNC682302-100 1x 100 µL

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF488A conjugate, 0.1mg/mL
BNC881880-500 1x 500 µL

Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details