Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant L-alanine exporter AlaE (alaE)

This Recombinant L-alanine exporter AlaE (alaE) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

L-alanine exporter AlaE

UniProt

Q0WJC2

Expression Region

1-148

Origin

Yersinia pestis

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTMFSTGPRWRSAVADTFALVVYCFVIGMAIEVVISGMTFRQSLSSRLLSIPVNILIAWP YGMYRDAFIRFAQRHAGQRFWARNLADLLAYVSFQSPVYAMILWSVGADFEQMISAVASN AVVSMVMGVAYGYFLEYCRRLFRVAGYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human G0S2 activation kit by CRISPRa
GA109415 1 Kit

Human G0S2 activation kit by CRISPRa

Sign In for Pricing
View Details
SRP54 Human Gene Knockout Kit (CRISPR)
KN401658 1 Kit

SRP54 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Duodenum
CR559574 5 µg

Tissue Total RNA, Duodenum

Sign In for Pricing
View Details
3,3'-Diacetyl-cis-azobenzene
TRC-D754260-50MG 50 mg

3,3'-Diacetyl-cis-azobenzene

Sign In for Pricing
View Details
Pigment Red 23 (tech grade)
TRC-P437790-250MG 250 mg

Pigment Red 23 (tech grade)

Sign In for Pricing
View Details
Biotin Methyltetrazine
#96038 1x 1 mg

Biotin Methyltetrazine

Sign In for Pricing
View Details