Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant L-alanine exporter AlaE (alaE)

This Recombinant L-alanine exporter AlaE (alaE) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

L-alanine exporter AlaE

UniProt

Q0WJC2

Expression Region

1-148

Origin

Yersinia pestis

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTMFSTGPRWRSAVADTFALVVYCFVIGMAIEVVISGMTFRQSLSSRLLSIPVNILIAWP YGMYRDAFIRFAQRHAGQRFWARNLADLLAYVSFQSPVYAMILWSVGADFEQMISAVASN AVVSMVMGVAYGYFLEYCRRLFRVAGYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Doublecortin (DCX) (NM_001195553) Human Over-expression Lysate
LC434187 20 µg

Doublecortin (DCX) (NM_001195553) Human Over-expression Lysate

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3257), CF488A conjugate, 0.1mg/mL
BNC883257-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3257), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SLC25A41 activation kit by CRISPRa
GA117149 1 Kit

Human SLC25A41 activation kit by CRISPRa

Sign In for Pricing
View Details
Trappc14 Mouse Gene Knockout Kit (CRISPR)
KN502037 1 Kit

Trappc14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SHARPIN (NM_030974) Human Recombinant Protein
TP322012 20 µg

SHARPIN (NM_030974) Human Recombinant Protein

Sign In for Pricing
View Details
SLC41A3 Rabbit Polyclonal Antibody
TA368364 100 µL

SLC41A3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details