Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant L-alanine exporter AlaE (alaE)

This Recombinant L-alanine exporter AlaE (alaE) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

L-alanine exporter AlaE

UniProt

Q0WJC2

Expression Region

1-148

Origin

Yersinia pestis

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTMFSTGPRWRSAVADTFALVVYCFVIGMAIEVVISGMTFRQSLSSRLLSIPVNILIAWP YGMYRDAFIRFAQRHAGQRFWARNLADLLAYVSFQSPVYAMILWSVGADFEQMISAVASN AVVSMVMGVAYGYFLEYCRRLFRVAGYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF647 conjugate, 0.1mg/mL
BNC470940-500 1x 500 µL

Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FITC Anti-Rat CD71 Antibody[OX-26]
AN00622C-01 50 Tests

FITC Anti-Rat CD71 Antibody[OX-26]

Sign In for Pricing
View Details
FITC Anti-Rat CD71 Antibody[OX-26]
AN00622C-02 100 Tests

FITC Anti-Rat CD71 Antibody[OX-26]

Sign In for Pricing
View Details
FITC Anti-Rat CD71 Antibody[OX-26]
AN00622C-03 2x 100 Tests

FITC Anti-Rat CD71 Antibody[OX-26]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS622632 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
WDSUB1 (NM_001128213) Human Over-expression Lysate
LC426927 20 µg

WDSUB1 (NM_001128213) Human Over-expression Lysate

Sign In for Pricing
View Details