Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig 5-hydroxytryptamine receptor 1E (HTR1E)

This Recombinant Pig 5-hydroxytryptamine receptor 1E (HTR1E) spans the amino acid sequence from region 1-149.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1E, 5-HT-1E, 5-HT1E, Serotonin receptor 1E

UniProt

Q29003

Expression Region

1-149

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

HQPANYLICSLAVTDLLVAVLVMPLSIMYIVMDSWRLGYFICEVWLSVDMTCCTCSILHL CVIALDRYWAITNAIEYARKRTAKRAGLMILTVWTISIFISMPPLFWRSHRQLSPPPSQC AIQHDHVIYTIYSTLGAFYIPLTLILILY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ficolin-2, C-His Tag
HA211174-01 20 µg

Human Ficolin-2, C-His Tag

Sign In for Pricing
View Details
Human Ficolin-2, C-His Tag
HA211174-02 50 µg

Human Ficolin-2, C-His Tag

Sign In for Pricing
View Details
Human Ficolin-2, C-His Tag
HA211174-03 100 µg

Human Ficolin-2, C-His Tag

Sign In for Pricing
View Details
Recombinant SIRP alpha Antibody
RC-15866-01 50 μL

Recombinant SIRP alpha Antibody

Sign In for Pricing
View Details
Recombinant SIRP alpha Antibody
RC-15866-02 100 µL

Recombinant SIRP alpha Antibody

Sign In for Pricing
View Details
Recombinant SIRP alpha Antibody
RC-15866-03 1 mL

Recombinant SIRP alpha Antibody

Sign In for Pricing
View Details