Recombinant Acinetobacter baumannii UPF0756 membrane protein A1S_2121 (A1S_2121)
This Recombinant Acinetobacter baumannii UPF0756 membrane protein A1S_2121 (A1S_2121) spans the amino acid sequence from region 1-150.
Product Specifications
Product Name Alternative
UPF0756 membrane protein A1S_2121
UniProt
A3M6K4
Expression Region
1-150
Origin
Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLAQFDVNLVVLLVLLICGLLSQNAAVTIAAGILIVIKITPLNQFFPYIQAHGLNLGILI LTIGVLTPIASGKLSGESILKSFISFKSLVAIAIGLLVAWLGGRGVKLMSSQPDVVAGLL IGTVAGVALLRGVPVGPLIAAGLLSLFIGK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042853-100 1x 100 µL
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680525-500 1x 500 µL
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 