Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M2 Lipoprotein signal peptidase (lspA)

This Recombinant Streptococcus pyogenes serotype M2 Lipoprotein signal peptidase (lspA) spans the amino acid sequence from region 1-152.

Product Specifications

Product Name Alternative

Lipoprotein signal peptidase, EC= 3.4.23.36, Prolipoprotein signal peptidase, Signal peptidase II, SPase II

UniProt

Q1JHH8

Expression Region

1-152

Origin

Streptococcus pyogenes serotype M2 (strain MGAS10270)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKRLFVLSLILLVALDQLSKFWIVSHIALGEVKPFIPGIVSLTYLQNNGAAFSILQDQQ WFFVVITVLVIGYAIYYLATHPHLNIWKQLALLLIISGGIGNFIDRLRLAYVIDMIHLDF MDFAIFNVADSYLTVGVILLVICLWKEEDYGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dodecylbenzene
TRC-D123310-25G 25 g

Dodecylbenzene

Sign In for Pricing
View Details
BglI, 600U
RV1142 600 U

BglI, 600U

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (rCTNNB1/2173), CF647 conjugate, 0.1mg/mL
BNC472173-100 1x 100 µL

Catenin, beta (CTNNB1) (rCTNNB1/2173), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sbf1 Mouse Gene Knockout Kit (CRISPR)
KN515316 1 Kit

Sbf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mucin 6 (MUC6) (CLH5), CF568 conjugate, 0.1mg/mL
BNC680891-100 1x 100 µL

Mucin 6 (MUC6) (CLH5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (rC3e/1308), CF640R conjugate, 0.1mg/mL
BNC403631-100 1x 100 µL

CD3e (T-Cell Marker) (rC3e/1308), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details