Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SYS1 homolog (SYS1)

This Recombinant Human Protein SYS1 homolog (SYS1) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

Protein SYS1 homolog

UniProt

Q8N2H4

Expression Region

1-156

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFST PPGRLSMMSFILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWW LVQAVCIALMAVIGEYLCMRTELKEIPLNSAPKSNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zic1 Recombinant Rabbit Monoclonal Antibody [JA31-60]
ET1704-96 100 µL

Zic1 Recombinant Rabbit Monoclonal Antibody [JA31-60]

Sign In for Pricing
View Details
APC Anti-Mouse CD31 Antibody[390]
E-AB-F1180UE-01 25 µg

APC Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
APC Anti-Mouse CD31 Antibody[390]
E-AB-F1180UE-02 100 µg

APC Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2467), 1mg/mL
BNUM2467-50 1x 50 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2467), 1mg/mL

Sign In for Pricing
View Details
HAO2 (NM_001005783) Human Over-expression Lysate
LY423655 100 µg

HAO2 (NM_001005783) Human Over-expression Lysate

Sign In for Pricing
View Details
LSM14A (NM_001114093) Human Over-expression Lysate
LY426447 100 µg

LSM14A (NM_001114093) Human Over-expression Lysate

Sign In for Pricing
View Details