Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 (mnhE1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 (mnhE1) spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit E1, Mnh complex subunit E1

UniProt

Q6GIE0

Expression Region

1-159

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APELA (NM_001297550) Human Recombinant Protein
TP701095 50 µg

APELA (NM_001297550) Human Recombinant Protein

Sign In for Pricing
View Details
Laboratory Water Purification System BLPS-201
BLPS-201 1 Unit

Laboratory Water Purification System BLPS-201

Sign In for Pricing
View Details
CD5 (C5/473), Biotin conjugate, 0.1mg/mL
BNCB0473-500 1x 500 µL

CD5 (C5/473), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STARS (ABRA) (NM_139166) Human Recombinant Protein
TP311264L 1 mg

STARS (ABRA) (NM_139166) Human Recombinant Protein

Sign In for Pricing
View Details
BID Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A1]
TA506762BM 100 µL

BID Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A1]

Sign In for Pricing
View Details
AATOM™ 620 NHS ester
70261-AAT 1 mg

AATOM™ 620 NHS ester

Sign In for Pricing
View Details