Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 (mnhE1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1 (mnhE1) spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit E1, Mnh complex subunit E1

UniProt

Q6GIE0

Expression Region

1-159

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKL VIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLG VSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Butyrylglycine-13C2,15N
TRC-N485623-2.5MG 2.5 mg

N-Butyrylglycine-13C2,15N

Sign In for Pricing
View Details
Screen Quest™ Fluorimetric Fatty Acid Uptake Assay Kit
36385-AAT 100 Tests

Screen Quest™ Fluorimetric Fatty Acid Uptake Assay Kit

Sign In for Pricing
View Details
LMO2 (B-Cell Marker) (LMO2/1971), CF640R conjugate, 0.1mg/mL
BNC401971-100 1x 100 µL

LMO2 (B-Cell Marker) (LMO2/1971), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ROR alpha (RORA) activation kit by CRISPRa
GA104130 1 Kit

Human ROR alpha (RORA) activation kit by CRISPRa

Sign In for Pricing
View Details
SF3A3 (NM_006802) Human Recombinant Protein
TP303895L 1 mg

SF3A3 (NM_006802) Human Recombinant Protein

Sign In for Pricing
View Details
GDF15 (NM_004864) Human Over-expression Lysate
LC401529 20 µg

GDF15 (NM_004864) Human Over-expression Lysate

Sign In for Pricing
View Details