Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yoaS (yoaS)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yoaS (yoaS) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yoaS

UniProt

O31833

Expression Region

1-160

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRMSTIFLKIALVLIGIPILALCIFLVPKVANYSAELFPNIAYIKYLVFIYLYVTAIPF YFALYQAFKLLSYIDKNKAFSGLSVRALKNIKYCAVTISIFYAAGMPVFYLMAEIDDAPG IIVIGLVIIFASMVIAVFAAVLQKLLKEAIDIKSENDLTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Cytoplasmic tRNA 2-thiolation protein 2 (C16orf84) ELISA Kit
MBS7205436-01 48 Well

Goat Cytoplasmic tRNA 2-thiolation protein 2 (C16orf84) ELISA Kit

Sign In for Pricing
View Details
Goat Cytoplasmic tRNA 2-thiolation protein 2 (C16orf84) ELISA Kit
MBS7205436-02 96 Well

Goat Cytoplasmic tRNA 2-thiolation protein 2 (C16orf84) ELISA Kit

Sign In for Pricing
View Details
Goat Cytoplasmic tRNA 2-thiolation protein 2 (C16orf84) ELISA Kit
MBS7205436-03 5x 96 Well

Goat Cytoplasmic tRNA 2-thiolation protein 2 (C16orf84) ELISA Kit

Sign In for Pricing
View Details
Goat Cytoplasmic tRNA 2-thiolation protein 2 (C16orf84) ELISA Kit
MBS7205436-04 10x 96 Well

Goat Cytoplasmic tRNA 2-thiolation protein 2 (C16orf84) ELISA Kit

Sign In for Pricing
View Details
Uric Acid Assay Kit (Spectrophotometry)
orb3132017 50 Tests

Uric Acid Assay Kit (Spectrophotometry)

Sign In for Pricing
View Details
PPAT 3'UTR GFP Stable Cell Line
TU068534 1.0 mL

PPAT 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details