Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Megalops atlanticus Cytochrome c oxidase subunit 1 (mt-co1)

This Recombinant Megalops atlanticus Cytochrome c oxidase subunit 1 (mt-co1) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 1, EC= 1.9.3.1, Cytochrome c oxidase polypeptide I

UniProt

P29648

Expression Region

1-160

Origin

Megalops atlanticus (Tarpon) (Clupea gigantea)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YQHLFWFFGHPEVYILILPGFGMISHIVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAH HMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGSIKWDTPLLWALGFIFLFTV GGLTGIVLANSSIDIVLHDTYYVVAHFHYVLSMGAVFAIM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-100 1x 100 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-100 1x 100 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF647 conjugate, 0.1mg/mL
BNC470164-100 1x 100 µL

CD28 (204.12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-100 1x 100 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8b, Mouse (H35-17.2), CF405S conjugate, 0.1mg/mL
BNC042003-100 1x 100 µL

CD8b, Mouse (H35-17.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details