Recombinant V-type proton ATPase 16 kDa proteolipid subunit 2/3 (vha-2)
This Recombinant V-type proton ATPase 16 kDa proteolipid subunit 2/3 (vha-2) spans the amino acid sequence from region 1-161.
Product Specifications
Product Name Alternative
V-type proton ATPase 16 kDa proteolipid subunit 2/3, V-ATPase 16 kDa proteolipid subunit 2/3, Vacuolar proton pump 16 kDa proteolipid subunit 2/3
UniProt
Q612A5
Expression Region
1-161
Origin
Caenorhabditis briggsae
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSYDLETAEHAAYAPFFGYMGAASAQIFTVLGAAYGTAKSAVGICSMGVMRPELIMKSVI PVIMAGIIGIYGLVVAMVLKGKVQAASAGYDLNKGFAHLAAGLTCGLCGLGAGYAIGIVG DAGVRGTAQQPRLFVGMILILIFSEVLGLYGMIVALILGTS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680806-100 1x 100 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
