Recombinant Oryza sativa subsp. indica CASP-like protein OsI_01075 (OsI_01075)
This Recombinant Oryza sativa subsp. indica CASP-like protein OsI_01075 (OsI_01075) spans the amino acid sequence from region 1-162.
Product Specifications
Product Name Alternative
CASP-like protein OsI_01075
UniProt
A2WMK7
Expression Region
1-162
Origin
Oryza sativa subsp. indica (Rice)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MFSAKARWIVAVVLRVAAAGAAAVAAVLMAMSHDEVIVYGMEVQAKFRYTPSLVFFVAAN AAVSACSLVVLLVPSSTSKLAARLLLMADVVLGMVLAGAFAAAGAMAELGKNGNSHAGWI AICVQVPLFCDRVRSALVAGSATIVLYYLMLMYSIYTLPMFP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details