Recombinant Staphylococcus aureus Lipoprotein signal peptidase (lspA)
This Recombinant Staphylococcus aureus Lipoprotein signal peptidase (lspA) spans the amino acid sequence from region 1-163.
Product Specifications
Product Name Alternative
Lipoprotein signal peptidase, EC= 3.4.23.36, Prolipoprotein signal peptidase, Signal peptidase II, SPase II
UniProt
P65267
Expression Region
1-163
Origin
Staphylococcus aureus (strain N315)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MHKKYFIGTSILIAVFVVIFDQVTKYIIATTMKIGDSFEVIPHFLNITSHRNNGAAWGIL SGKMTFFFIITIIILIALVYFFIKDAQYNLFMQVAISLLFAGALGNFIDRILTGEVVDFI DTNIFGYDFPIFNIADSSLTIGVILIIIALLKDTSNKKEKEVK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741081-100 1x 100 µL
CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401003-500 1x 500 µL
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details