Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chromobacterium violaceum Disulfide bond formation protein B (dsbB)

This Recombinant Chromobacterium violaceum Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-166.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

Q7NT68

Expression Region

1-166

Origin

Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLNITNRQGFLLVAAACAGAIGFALFAQYQLGEEPCPLCILQRIGVMAVGALALLAALH NPGKTGAKVWGGLMTLAALSGAGVSLRQLWLQSLPADQVPQCGPGLEFLMESFPLWEVLS KVLKGSGECAAIQGRFLGMTMPFWVAVFFAGVIVWTLWLVGRRRRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XTP3TPA (DCTPP1) (N-term) Rabbit Polyclonal Antibody
AP12472PU-N 400 µL

XTP3TPA (DCTPP1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VSX1 Rabbit Polyclonal Antibody
TA369761 100 µL

VSX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POLG2 (NM_007215) Human Recombinant Protein
TP303462 20 µg

POLG2 (NM_007215) Human Recombinant Protein

Sign In for Pricing
View Details
CK-8 Polyclonal Antibody
E-AB-70236-01 60 µL

CK-8 Polyclonal Antibody

Sign In for Pricing
View Details
CK-8 Polyclonal Antibody
E-AB-70236-02 120 µL

CK-8 Polyclonal Antibody

Sign In for Pricing
View Details
CK-8 Polyclonal Antibody
E-AB-70236-03 200 µL

CK-8 Polyclonal Antibody

Sign In for Pricing
View Details