Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epithelial membrane protein 2 (EMP2)

This Recombinant Human Epithelial membrane protein 2 (EMP2) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

Epithelial membrane protein 2, EMP-2, Protein XMP

UniProt

P54851

Expression Region

1-167

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST LQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRR EDIHDKNAKFYPVTREGSYGYSYILAWVAFACTFISGMMYLILRKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX11 (NM_004375) Human 3' UTR Clone
SC215177 10 µg

COX11 (NM_004375) Human 3' UTR Clone

Sign In for Pricing
View Details
Tuberin Rabbit mAb
58891 50 µL

Tuberin Rabbit mAb

Sign In for Pricing
View Details
Anti-KEAP1 Antibody Picoband
MBS1754749-01 0.01 mg

Anti-KEAP1 Antibody Picoband

Sign In for Pricing
View Details
Anti-KEAP1 Antibody Picoband
MBS1754749-02 0.1 mg (Carrier Free)

Anti-KEAP1 Antibody Picoband

Sign In for Pricing
View Details
Anti-KEAP1 Antibody Picoband
MBS1754749-03 0.1 mg

Anti-KEAP1 Antibody Picoband

Sign In for Pricing
View Details
Anti-KEAP1 Antibody Picoband
MBS1754749-04 0.1 mg (Cy3)

Anti-KEAP1 Antibody Picoband

Sign In for Pricing
View Details