Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens Disulfide bond formation protein B 1 (dsbB1)

This Recombinant Pseudomonas fluorescens Disulfide bond formation protein B 1 (dsbB1) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B 1, Disulfide oxidoreductase 1

UniProt

Q3K767

Expression Region

1-169

Origin

Pseudomonas fluorescens (strain Pf0-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEETIRLGRERRYLVLLGIICLALIGGALYMQIVLGEAPCPLCILQRYALLLIALFAFI GAAMRTRRSITVFEVLVVICAIAGAGVAGHHVYTQFYPAVSCGIDVLQPIVDDLPLAKIF PLGFQVDGFCSTPYPPILGLSLAQWALVAFVLVVILVPLLTSRNRKALR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

trans-N-(3-Chloroallyl)-1-(R)-aminoindan Hydrochloride
TRC-D297225-250MG 250 mg

trans-N-(3-Chloroallyl)-1-(R)-aminoindan Hydrochloride

Sign In for Pricing
View Details
(Z)-Octa-1,5-dien-3-one
TRC-O235830-50MG 50 mg

(Z)-Octa-1,5-dien-3-one

Sign In for Pricing
View Details
amyA Goat Polyclonal Antibody
TA396701S 25 µL

amyA Goat Polyclonal Antibody

Sign In for Pricing
View Details
TRIM33 Antibody
KC-30928-01 50 μL

TRIM33 Antibody

Sign In for Pricing
View Details
TRIM33 Antibody
KC-30928-02 100 µL

TRIM33 Antibody

Sign In for Pricing
View Details
TRIM33 Antibody
KC-30928-03 1 mL

TRIM33 Antibody

Sign In for Pricing
View Details