Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. lactis UPF0177 protein yxdF (yxdF)

This Recombinant Lactococcus lactis subsp. lactis UPF0177 protein yxdF (yxdF) spans the amino acid sequence from region 1-177.

Product Specifications

Product Name Alternative

UPF0177 protein yxdF

UniProt

Q9CDG9

Expression Region

1-177

Origin

Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLVLILIFIIAWKLGYLKNTLKNWDLKRIFWLMGIVFFTLATNYLVTVLVLKTQIISSV TSDTGMSDILGQLPILCQKYILGIIVPLSEELLFRSYIFGSITNKKVAFLISSVLFALVH TGFSWYLLPYLILSFIITWVYSKRNNFIESAIVHSSVNLFGGSAIKLLDTFFKLLPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANP (NPPA) Rabbit Polyclonal Antibody
TA379262 100 µL

ANP (NPPA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Biotin Conjugated Ulex europaeus Lectin (GorseFurze) -UEA-II-
BA-2202-2 2 mg

Biotin Conjugated Ulex europaeus Lectin (GorseFurze) -UEA-II-

Sign In for Pricing
View Details
Recombinant Human CXCL12 Protein (His Tag)
PDEH101126-01 20 µg

Recombinant Human CXCL12 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CXCL12 Protein (His Tag)
PDEH101126-02 100 µg

Recombinant Human CXCL12 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CXCL12 Protein (His Tag)
PDEH101126-03 500 µg

Recombinant Human CXCL12 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CXCL12 Protein (His Tag)
PDEH101126-04 1 mg

Recombinant Human CXCL12 Protein (His Tag)

Sign In for Pricing
View Details