Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_478855 (ARALYDRAFT_478855)

This Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_478855 (ARALYDRAFT_478855) spans the amino acid sequence from region 1-178.

Product Specifications

Product Name Alternative

CASP-like protein ARALYDRAFT_478855

UniProt

D7L342

Expression Region

1-178

Origin

Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKTDQTAIDGSALELNRTEKTVEAVLRVASMALSITGLVIMIKNSISNDFGSLSYSNLG AFMYLVGANGVCAAYSLLSALAILALPCPISKVQVRTLFLLDQVVTYVVLAAGAVSAETV YLAYYGNIPITWSSACDSYGIFCHKALISVVFTFVVSLLYMLLSLISSYRLFSRFEAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-500 1x 500 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL
BNC880257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-500 1x 500 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
BNC470225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-100 1x 100 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF488A conjugate, 0.1mg/mL
BNC881619-100 1x 100 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details