Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Disulfide bond formation protein B (dsbB)

This Recombinant Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-178.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

Q87N03

Expression Region

1-178

Origin

Vibrio parahaemolyticus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIFSSLNQFSKGHVSWLLLLLFIIFFEACALYFQHVMMLAPCVMCIYERVAMMGIGGAA IIGLIAPNNALFRWLGLIGWGLSSYKGLMLAMQHVDYQFNPSPFATCDLFVTFPSWAPLN QWVPWMFEAYGDCSKIVWQFFDLSMPQWLVVIFAGNLVALALIVIAQFFPVKRKNPIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE6C (NM_006204) Human Over-expression Lysate
LC416801 20 µg

PDE6C (NM_006204) Human Over-expression Lysate

Sign In for Pricing
View Details
AP1G1 Antibody, Biotin conjugated
A12773-50UG 50 µg

AP1G1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS708870 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
RPS6KB3 sgRNA CRISPR Lentivector (Human) (Target 3)
K2014804 1.0 µg DNA

RPS6KB3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
253J
ABC-TC0005 1 Vial

253J

Sign In for Pricing
View Details
Compound Fr13051
Fr13051-01 100 mg

Compound Fr13051

Sign In for Pricing
View Details