Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable intracellular septation protein A (yciB)

This Recombinant Probable intracellular septation protein A (yciB) spans the amino acid sequence from region 1-179.

Product Specifications

Product Name Alternative

Probable intracellular septation protein A

UniProt

P59440

Expression Region

1-179

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQSVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha 1 Antitrypsin (SERPINA1) Human Gene Knockout Kit (CRISPR)
KN202082RB 1 Kit

alpha 1 Antitrypsin (SERPINA1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant STAT6 Antibody
RC-16964-01 50 μL

Recombinant STAT6 Antibody

Sign In for Pricing
View Details
Recombinant STAT6 Antibody
RC-16964-02 100 µL

Recombinant STAT6 Antibody

Sign In for Pricing
View Details
Recombinant STAT6 Antibody
RC-16964-03 1 mL

Recombinant STAT6 Antibody

Sign In for Pricing
View Details
SLC25A6 (NM_001636) Human Over-expression Lysate
LY419829 100 µg

SLC25A6 (NM_001636) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytochrome p450 (M12P4H2), CF488A conjugate, 0.1mg/mL
BNC882199-500 1x 500 µL

Cytochrome p450 (M12P4H2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details